PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_05427_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Dof
Protein Properties Length: 250aa    MW: 27067.5 Da    PI: 8.4786
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_05427_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.44.3e-401777262
                      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                ++++lkcprCdstntkfCyynny+l+qPr+fCk+CrryWtkGGalrn+PvGgg+rkn k+s
  Cotton_A_05427_BGI-A2_v1.0 17 EQEQLKCPRCDSTNTKFCYYNNYNLAQPRHFCKSCRRYWTKGGALRNIPVGGGTRKNSKRS 77
                                57899****************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-281372IPR003851Zinc finger, Dof-type
PfamPF027012.7E-331975IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3572175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MHDPTDFQQM KAPVFPEQEQ LKCPRCDSTN TKFCYYNNYN LAQPRHFCKS CRRYWTKGGA  60
LRNIPVGGGT RKNSKRSSSS DSSSQPKRQS NPAPDSIRNQ NLSDSSPPPT IPQQVLLSSA  120
VQNSVSDADQ TRMYVLSLDH QARKMTDTGG SFSSLLASSG QFRNLLNGLN PNGSGSETAH  180
TDDFGGNLAS GRGIGPSSDR DPRLRESNNS NNESYFGVQG GGGGGDTNCW TGCSNGWPDL  240
AIYTPGSSFH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447736.11e-164PREDICTED: dof zinc finger protein DOF3.1
TrEMBLA0A0D2QFK31e-164A0A0D2QFK3_G
STRINGGLYMA07G01461.14e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-38DOF zinc finger protein 1